Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CLEC4E/Mincel (C-6His)

Source: Human Cells. MW :21.7kD. Recombinant Human CLEC4E is produced by our Mammalian expression system and the target gene encoding Arg41-Leu219 is expressed with a 6His tag at the C-terminus. C-Type Lectin Domain Family 4 Member E (CLEC4E) is a 219 amino acid single-pass type II membrane protein that contains one C-type Lectin domain. It is expressed in monocytes, CLEC4E functions as a downstream target of C/EBP beta and is thought to play a role in the inflammatory response, possibly via transcriptional control of C/EBP beta. CLEC4E may play a role in the response to inflammatory stimuli in peritoneal macrophages and may be involved in immune surveillance processes under transcriptional control of CEBPB. Human CLEC4E shares 67% sequence identity with its mouse counterpart, suggesting a similar function between species. CLEC-4E exists as multiple alternatively spliced isoforms that are encoded by a gene which maps to a natural killer gene complex region on human chromosome 12.

Product Specifications

Gene Name

CLEC4E

Gene ID

26253

UniProt

Q9ULY5

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

RCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSLVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Vmn1r113 (NM_001166716) Mouse Tagged ORF Clone
MG223325 10 µg

Vmn1r113 (NM_001166716) Mouse Tagged ORF Clone

Ask
View Details
Lentiviral human CD14 shRNA (UAS) - Lentiviral human CD14 shRNA (UAS, RFP) (25)
GTR15316046 1 Vial

Lentiviral human CD14 shRNA (UAS) - Lentiviral human CD14 shRNA (UAS, RFP) (25)

Ask
View Details
Mouse Monoclonal Apolipoprotein E3/ApoE3 Antibody (960319) [DyLight 755]
MAB41442IR 100 µL

Mouse Monoclonal Apolipoprotein E3/ApoE3 Antibody (960319) [DyLight 755]

Ask
View Details
AGR2 CytoSection
TS402023P5 25 Slides

AGR2 CytoSection

Ask
View Details
Compound Fr12749
MF-0007315-01 50 mg

Compound Fr12749

Ask
View Details
Compound Fr12749
MF-0007315-02 200 mg

Compound Fr12749

Ask
View Details