Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CLEC10A/CD301 (C-6His)

Source: Human Cells. MW :29.8kD. Recombinant Human CLEC10A is produced by our Mammalian expression system and the target gene encoding Gln61-His316 is expressed with a 6His tag at the C-terminus. C-Type Lectin Domain Family 10 Member A (CLEC10A) is a type II transmembrane C-type lectin that is expressed on immature myleloid dendritic cells and alternatively activated (tolerogenic) macrophages. CLEC10A/MGL binds and internalizes molecules with terminal nonsialylated GalNAc carbohydrates such as the Tn carcinoma antigen. CLEC10A/MGL also binds the GP envelope glycoprotein on Marburg and Ebola viruses and enhances viral entry and infectivity. It constitute a unique class of C-type lectins because of their specificity for galactose and its structural homologues. CLEC10A is thought to participate in the recognition of molecules from both altered self and pathogens due to its monosaccharide specificity for Gal and N-acetylgalactosamine (GalNAc) . Human and rat carry a single gene for CLEC10A/MGL, while mouse has two closely related MGL1 and MGL2 genes.

Product Specifications

Gene Name

CLEC10A

Gene ID

10462

UniProt

Q8IUN9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESHVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Duck Aldo-Keto Reductase Family 1 Member C1 (AKR1C1) ELISA Kit
MBS9924917 Inquire

Duck Aldo-Keto Reductase Family 1 Member C1 (AKR1C1) ELISA Kit

Ask
View Details
Laminin alpha 1 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-41199R-PE-Cy5.5 100 µL

Laminin alpha 1 Polyclonal Antibody, PE-Cy5.5 Conjugated

Ask
View Details
LSP1 (NM_002339) Human Mass Spec Standard
PH300712 10 µg

LSP1 (NM_002339) Human Mass Spec Standard

Ask
View Details
Cckar (Cholecystokinin Receptor Type A, CCK-A Receptor, CCK-AR, Cholecystokinin-1 Receptor, CCK1-R, Cckar) (FITC) discontinued
302330-FITC 100 µL

Cckar (Cholecystokinin Receptor Type A, CCK-A Receptor, CCK-AR, Cholecystokinin-1 Receptor, CCK1-R, Cckar) (FITC) discontinued

Ask
View Details
C2cd4c Rat shRNA Lentiviral Particle (Locus ID 500798)
TL707787V 500 µL Each

C2cd4c Rat shRNA Lentiviral Particle (Locus ID 500798)

Ask
View Details
1,3-Dioleoylglycerol-d5
HY-143021S-01 1 mg

1,3-Dioleoylglycerol-d5

Ask
View Details