Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD8 beta Chain/CD8B (C-6His)

Source: Human Cells. MW :17.8kD. Recombinant Human CD8B is produced by our Mammalian expression system and the target gene encoding Leu22-Pro170 is expressed with a 6His tag at the C-terminus. T-Cell Surface Glycoprotein CD8 beta Chain (CD8 Antigen) is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. CD8 Antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified.

Product Specifications

Gene Name

CD8B

Gene ID

926

UniProt

P10966

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD39 (ETDH1, LCAA, Ecto-ATPase 1, Ecto-apyrase, ENTPD1, Ectonucleoside triphosphate diphosphohydrolase 1, NTPDase-1, Nucleoside triphosphate diphosphohydrolase 1) (PE)
046274-PE 100 Tests

CD39 (ETDH1, LCAA, Ecto-ATPase 1, Ecto-apyrase, ENTPD1, Ectonucleoside triphosphate diphosphohydrolase 1, NTPDase-1, Nucleoside triphosphate diphosphohydrolase 1) (PE)

Ask
View Details
NPR2 (Natriuretic Peptide Receptor B/Guanylate Cyclase B (atrionatriuretic peptide Receptor B), AMDM, ANPRB, GUC2B, GUCY2B, NPRB, NPRBi) (Biotin)
MBS6170901-01 0.1 mL

NPR2 (Natriuretic Peptide Receptor B/Guanylate Cyclase B (atrionatriuretic peptide Receptor B), AMDM, ANPRB, GUC2B, GUCY2B, NPRB, NPRBi) (Biotin)

Ask
View Details
NPR2 (Natriuretic Peptide Receptor B/Guanylate Cyclase B (atrionatriuretic peptide Receptor B), AMDM, ANPRB, GUC2B, GUCY2B, NPRB, NPRBi) (Biotin)
MBS6170901-02 5x 0.1 mL

NPR2 (Natriuretic Peptide Receptor B/Guanylate Cyclase B (atrionatriuretic peptide Receptor B), AMDM, ANPRB, GUC2B, GUCY2B, NPRB, NPRBi) (Biotin)

Ask
View Details
FHL1 Polyclonal Antibody
MBS2522091-01 0.02 mL

FHL1 Polyclonal Antibody

Ask
View Details
FHL1 Polyclonal Antibody
MBS2522091-02 0.06 mL

FHL1 Polyclonal Antibody

Ask
View Details
FHL1 Polyclonal Antibody
MBS2522091-03 0.12 mL

FHL1 Polyclonal Antibody

Ask
View Details