Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B- and T-Lymphocyte Attenuator/BTLA/CD272 (C-6His)

Source: Human Cells. MW :14.79kD. Recombinant Human BTLA is produced by our Mammalian expression system and the target gene encoding Lys31-Leu150 is expressed with a 6His tag at the C-terminus. B- and T-Lymphocyte Attenuator (BTLA) is a single-pass type I membrane protein containing 1 Ig-like V-type (immunoglobulin-like) domain. BTLA expression is induced during activation of T cells, and BTLA remains expressed on Th1 cells but not Th2 cells. Like PD1 and CTLA4, BTLA interacts with a B7 homolog, B7H4. However, unlike PD-1 and CTLA-4, BTLA displays T-Cell inhibition via interaction with tumor necrosis family receptors (TNF-R), not just the B7 family of cell surface receptors. BTLA is a lymphocyte inhibitory receptor that inhibits lymphocytes during immune response. BTLA also is a ligand for tumor necrosis factor (receptor) superfamily, member 14 (TNFRSF14), also known as herpes virus entry mediator (HVEM) . BTLA-HVEM complexes negatively regulate T-cell immune responses.

Product Specifications

Gene Name

BTLA

Gene ID

151888

UniProt

Q7Z6A9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Crk-Like Protein (CRKL) Antibody (Biotin)
abx314806-01 20 µg

Crk-Like Protein (CRKL) Antibody (Biotin)

Ask
View Details
Crk-Like Protein (CRKL) Antibody (Biotin)
abx314806-02 50 µg

Crk-Like Protein (CRKL) Antibody (Biotin)

Ask
View Details
Crk-Like Protein (CRKL) Antibody (Biotin)
abx314806-03 100 µg

Crk-Like Protein (CRKL) Antibody (Biotin)

Ask
View Details
Crk-Like Protein (CRKL) Antibody (Biotin)
abx314806-04 200 µg

Crk-Like Protein (CRKL) Antibody (Biotin)

Ask
View Details
Crk-Like Protein (CRKL) Antibody (Biotin)
abx314806-05 1 mg

Crk-Like Protein (CRKL) Antibody (Biotin)

Ask
View Details
Mouse/Rat SIRP alpha/CD172a Alexa Fluor 488 MAb (Cl 772734)
FAB7307G 100 Tests

Mouse/Rat SIRP alpha/CD172a Alexa Fluor 488 MAb (Cl 772734)

Ask
View Details