Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B- and T-Lymphocyte Attenuator/BTLA/CD272 (C-6His)

Source: Human Cells. MW :14.79kD. Recombinant Human BTLA is produced by our Mammalian expression system and the target gene encoding Lys31-Leu150 is expressed with a 6His tag at the C-terminus. B- and T-Lymphocyte Attenuator (BTLA) is a single-pass type I membrane protein containing 1 Ig-like V-type (immunoglobulin-like) domain. BTLA expression is induced during activation of T cells, and BTLA remains expressed on Th1 cells but not Th2 cells. Like PD1 and CTLA4, BTLA interacts with a B7 homolog, B7H4. However, unlike PD-1 and CTLA-4, BTLA displays T-Cell inhibition via interaction with tumor necrosis family receptors (TNF-R), not just the B7 family of cell surface receptors. BTLA is a lymphocyte inhibitory receptor that inhibits lymphocytes during immune response. BTLA also is a ligand for tumor necrosis factor (receptor) superfamily, member 14 (TNFRSF14), also known as herpes virus entry mediator (HVEM) . BTLA-HVEM complexes negatively regulate T-cell immune responses.

Product Specifications

Gene Name

BTLA

Gene ID

151888

UniProt

Q7Z6A9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Natriuretic peptides B, NPPB GENLISA ELISA
KLR2105 96 Well

Rat Natriuretic peptides B, NPPB GENLISA ELISA

Sign In for Pricing
View Details
Lentiviral human KCNE2 shRNA (UAS) - Lentiviral human KCNE2 shRNA (UAS) (100)
GTR15101202 1 Vial

Lentiviral human KCNE2 shRNA (UAS) - Lentiviral human KCNE2 shRNA (UAS) (100)

Sign In for Pricing
View Details
CDYL Human shRNA Plasmid Kit (Locus ID 9425)
TL305463 1 Kit

CDYL Human shRNA Plasmid Kit (Locus ID 9425)

Sign In for Pricing
View Details
Lipustobart Biosimilar - Research Grade
ICH5254-1mg 1 mg

Lipustobart Biosimilar - Research Grade

Sign In for Pricing
View Details
MBP (Myelin Basic Protein, Myelin A1 protein, Myelin membrane encephalitogenic protein)
364079 200 µL

MBP (Myelin Basic Protein, Myelin A1 protein, Myelin membrane encephalitogenic protein)

Sign In for Pricing
View Details
Human SH3BP2 (SH3 Domain Binding Protein 2) ELISA Kit
EK244208 96 Well

Human SH3BP2 (SH3 Domain Binding Protein 2) ELISA Kit

Sign In for Pricing
View Details