Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human V-Set and Ig Domain-Containing Protein 4/VSIG4/CRIg (C-6His)

Source: Human Cells. MW :30.2kD. Recombinant Human VSIG4 is produced by our Mammalian expression system and the target gene encoding Arg20-Pro283 is expressed with a 6His tag at the C-terminus. V-Set and Immunoglobulin Domain-Containing Protein 4 (VSIG4) is a 45-50 kDa macrophage-specific transmembrane glycoprotein that belongs to the B7 family-related protein and an Ig superfamily member. In contrast to the B7 family members which contain two IgG domains, VSIG4 contains one complete V-type Ig domain and a truncated C-type I g domain. VSIG4 is abundantly expressed in several fetal tissues. In adult tissues, the highest expression of VSIG4 is in lung and placenta. It is also expressed in resting macrophages. No VSIG4 expression appears to be present in T and B cells. The specific expression of VSIG4 on resting macrophages in tissue suggests that this inhibitory ligand may be important for the maintenance of T cell unresponsiveness in healthy tissues. VSIG4 functions as a negative regulator of T cell activation, and may be involved in the maintenance of peripheral T cell tolerance, and is also identified as a potent suppressor of established inflammation. VSIG4 is a phagocytic receptor, strong negative regulator of T-cell proliferation and IL2 production. It is a potent inhibitor of the alternative complement pathway convertases. Human VSIG4 is 399 amino acids (aa) in length. It is a type I transmembrane (TM) glycoprotein that contains a 264 aa extracellular domain (ECD) (aa 20 - 283) and a 95 aa cytoplasmic region.

Product Specifications

Gene Name

VSIG4

Gene ID

11326

UniProt

Q9Y279

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-NDEL1 antibody
STJ28343 100 µl

Anti-NDEL1 antibody

Ask
View Details
Human CARD17 knockdown cell line
ABC-KD2358 1 Vial

Human CARD17 knockdown cell line

Ask
View Details
Rabbit Polyclonal ZADH2 Antibody [Allophycocyanin]
NBP2-98567APC 0.1 mL

Rabbit Polyclonal ZADH2 Antibody [Allophycocyanin]

Ask
View Details
BFAR Antibody (N-term) Blocking Peptide
MBS9221941-01 0.5 mg

BFAR Antibody (N-term) Blocking Peptide

Ask
View Details
BFAR Antibody (N-term) Blocking Peptide
MBS9221941-02 5x 0.5 mg

BFAR Antibody (N-term) Blocking Peptide

Ask
View Details
Sanggenone K
MF-0153262 25 mg

Sanggenone K

Ask
View Details