Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serpin Kazal-4/SPINK4 (C-6His)

Source: Human Cells. MW :7.73kD. Recombinant Human SPINK4 is produced by our Mammalian expression system and the target gene encoding Gly27-Cys86 is expressed with a 6His tag at the C-terminus. Serine Protease Inhibitor Kazal-Type 4 (SPINK4) is a secreted protein containing one Kazal-like domain. SPINK4 is a member of the SPINK protein family. The gene family of serine protease inhibitors of the Kazal type (SPINK) are functional and positional candidate genes for celiac disease (CD) . SPINK1 plays an important role in protecting the pancreas against excessive trypsinogen activation. It is a potent natural inhibitor of pancreatic trypsin activity. SPINK1 mutations are associated with the development of acute and chronic pancreatitis and have been detected in all forms of chronic pancreatitis. SPINK2 functions as a trypsin/acrosin inhibitor and is synthesized mainly in the testis and seminal vesicle where its activity is engaged in fertility. The SPINK2 protein contains a typical Kazal domain composed by six cysteine residues forming three disulfide bridges. SPINK9 was identified in human skin. Its expression was strong in palmar epidermis, but not detectable or very low in non palmoplantar skin.

Product Specifications

Gene Name

SPINK4

Gene ID

27290

UniProt

O60575

Components

Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, 2mM CaCl2, 1mM DTT, 0.05% Brij35, 10% Glycerol, pH 6.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GKLPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQDIQIMKDGKCVDHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCT1/SLC16A1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-11461 0.1 mg

MCT1/SLC16A1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
CAMK2A/CAMK2B/CAMK2D
308962-01 50 µg

CAMK2A/CAMK2B/CAMK2D

Sign In for Pricing
View Details
CAMK2A/CAMK2B/CAMK2D
308962-02 100 µg

CAMK2A/CAMK2B/CAMK2D

Sign In for Pricing
View Details
TBX2 discontinued
395202 200 µL

TBX2 discontinued

Sign In for Pricing
View Details
Sorcs2 (NM_001107225) Rat Tagged ORF Clone Lentiviral Particle
RR201329L3V 200 µL

Sorcs2 (NM_001107225) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse AST (Aspartate Aminotransferase) Microsample ELISA Kit
ELK1778MS-01 48 Tests

Mouse AST (Aspartate Aminotransferase) Microsample ELISA Kit

Sign In for Pricing
View Details