Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serpin Kazal-1 (C-6His)

Source: Human Cells. MW :7.28kD. Recombinant Human SPINK1 is produced by our Mammalian expression system and the target gene encoding Asp24-Cys79 is expressed with a 6His tag at the C-terminus. Serine Protease Inhibitor Kazal-Type 1 (SPINK1) is a trypsin inhibitor that prevent the trypsin-catalyzed premature activation of zymogens within the pancreas. Defects in SPINK1 are a cause of pancreatitis (PCTT) . A disease characterized by the presence of calculi in pancreatic ducts. It causes severe abdominal pain attacks. Defects in SPINK1 are the cause of susceptibility to tropical calcific pancreatitis (TCP) . Recombinant SPINK1 protein (rSPINK1) stimulated cell proliferation in benign RWPE as well as cancerous prostate cells. The research result indicated that the potential of SPINK1 as an extracellular therapeutic target in prostate cancer. In contrast, knockdown of SPINK1 in 22RV1 cells inhibited cell proliferation, cell invasion, and tumor growth in xenograft assays.

Product Specifications

Gene Name

SPINK1

Gene ID

6690

UniProt

P00995

Components

Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, 2mM CaCl2, 1mM DTT, 0.05% Brij35, 10% Glycerol, pH 6.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPCVDHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

FDX1 Rabbit Polyclonal Antibody
MBS9466625-01 0.05 mL

FDX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FDX1 Rabbit Polyclonal Antibody
MBS9466625-02 0.1 mL

FDX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FDX1 Rabbit Polyclonal Antibody
MBS9466625-03 5x 0.1 mL

FDX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Porcine ANGPTL4 (Angiopoietin Like Protein 4) ValidElisa Kit
EK344127 96 Well

Porcine ANGPTL4 (Angiopoietin Like Protein 4) ValidElisa Kit

Sign In for Pricing
View Details
PTP4A2, ID (Protein Tyrosine Phosphatase Type IVA 2, Protein-tyrosine Phosphatase 4a2, Protein-tyrosine Phosphatase Of Regenerating Liver 2, PRL-2, PTP (CAAXII), HU-PP-1, OV-1, BM-008, PTPCAAX2, PRL2) (FITC) discontinued
P9109-46A-FITC 200 µL

PTP4A2, ID (Protein Tyrosine Phosphatase Type IVA 2, Protein-tyrosine Phosphatase 4a2, Protein-tyrosine Phosphatase Of Regenerating Liver 2, PRL-2, PTP (CAAXII), HU-PP-1, OV-1, BM-008, PTPCAAX2, PRL2) (FITC) discontinued

Sign In for Pricing
View Details
Mouse Dual Specificity Phosphatase 1 ELISA Kit (DUSP1)
RK02758 96 Tests

Mouse Dual Specificity Phosphatase 1 ELISA Kit (DUSP1)

Sign In for Pricing
View Details