Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serpin Kazal-1 (C-6His)

Source: Human Cells. MW :7.28kD. Recombinant Human SPINK1 is produced by our Mammalian expression system and the target gene encoding Asp24-Cys79 is expressed with a 6His tag at the C-terminus. Serine Protease Inhibitor Kazal-Type 1 (SPINK1) is a trypsin inhibitor that prevent the trypsin-catalyzed premature activation of zymogens within the pancreas. Defects in SPINK1 are a cause of pancreatitis (PCTT) . A disease characterized by the presence of calculi in pancreatic ducts. It causes severe abdominal pain attacks. Defects in SPINK1 are the cause of susceptibility to tropical calcific pancreatitis (TCP) . Recombinant SPINK1 protein (rSPINK1) stimulated cell proliferation in benign RWPE as well as cancerous prostate cells. The research result indicated that the potential of SPINK1 as an extracellular therapeutic target in prostate cancer. In contrast, knockdown of SPINK1 in 22RV1 cells inhibited cell proliferation, cell invasion, and tumor growth in xenograft assays.

Product Specifications

Gene Name

SPINK1

Gene ID

6690

UniProt

P00995

Components

Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, 2mM CaCl2, 1mM DTT, 0.05% Brij35, 10% Glycerol, pH 6.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPCVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1, PFKFB1 ELISA kit
YLA3646HU-01 48 Tests

Human 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1, PFKFB1 ELISA kit

Ask
View Details
Human 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1, PFKFB1 ELISA kit
YLA3646HU-02 96 Tests

Human 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1, PFKFB1 ELISA kit

Ask
View Details
DARS1 (NM_001293312) Human Untagged Clone
SC335884 10 µg

DARS1 (NM_001293312) Human Untagged Clone

Ask
View Details
Cathepsin K Recombinant Protein Antigen
NBP2-58351PEP 100 µL

Cathepsin K Recombinant Protein Antigen

Ask
View Details
Rabbit Polyclonal DISP1 Antibody [Alexa Fluor 350]
NBP2-81818AF350 0.1 mL

Rabbit Polyclonal DISP1 Antibody [Alexa Fluor 350]

Ask
View Details
Aromatase (CYP19A1) Rabbit Polyclonal Antibody
TA321053 100 µL

Aromatase (CYP19A1) Rabbit Polyclonal Antibody

Ask
View Details