Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pulmonary Surfactant-Associated Protein D/PSP-D (C-6His)

Source: Human Cells. MW :36.46kD. Recombinant Human PSP-D is produced by our Mammalian expression system and the target gene encoding Ala21-Phe375 (Glu22Gly) is expressed with a 6His tag at the C-terminus. Surfactant Pulmonary-Associated Protein D (SP-D) is a 43 kDa member of the collectin family of innate immune modulators. Its principal components consist of a collagen-like region and a C-terminal carbohydrate recognition domain (CRD), a structure that places it in a subset of pattern recognition proteins termed defense collagens. SP-D is constitutively secreted by alveolar lining cells and epithelium associated with tubular structures and induced in cardiac smooth muscle and endothelial cells. It binds both secreted and transmembrane proteins that transduce its function. It binds human neutrophil defensins, modulating influenza anti-viral defense. It binds MD-2/LY96, a secreted protein that cooperates with Toll-like receptors (TLRs) in the response of macrophages to bacterial lipopolysaccharides (LPS) or cell wall components. It also binds macrophage CD14 and TLRs directly, blocking binding of LPS and down-regulating TNF-a secretion. SP-D binding of both SIRPa and the calreticulin/CD91 complex on macrophages allows for a graded response to environmental challenge.

Product Specifications

Gene Name

SFTPD

Gene ID

6441

UniProt

P35247

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEFVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Dihydro ferulic acid 4-O-sulfate sodium salt
272272-01 2 mg

Dihydro ferulic acid 4-O-sulfate sodium salt

Sign In for Pricing
View Details
Dihydro ferulic acid 4-O-sulfate sodium salt
272272-02 5 mg

Dihydro ferulic acid 4-O-sulfate sodium salt

Sign In for Pricing
View Details
Dihydro ferulic acid 4-O-sulfate sodium salt
272272-03 10 mg

Dihydro ferulic acid 4-O-sulfate sodium salt

Sign In for Pricing
View Details
Dihydro ferulic acid 4-O-sulfate sodium salt
272272-04 25 mg

Dihydro ferulic acid 4-O-sulfate sodium salt

Sign In for Pricing
View Details
Dihydro ferulic acid 4-O-sulfate sodium salt
272272-05 50 mg

Dihydro ferulic acid 4-O-sulfate sodium salt

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) DSDX Polyclonal Antibody
MBS7164787 Inquire

Rabbit anti-Escherichia coli (strain K12) DSDX Polyclonal Antibody

Sign In for Pricing
View Details