Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pulmonary Surfactant-Associated Protein D/PSP-D (C-6His)

Source: Human Cells. MW :36.46kD. Recombinant Human PSP-D is produced by our Mammalian expression system and the target gene encoding Ala21-Phe375 (Glu22Gly) is expressed with a 6His tag at the C-terminus. Surfactant Pulmonary-Associated Protein D (SP-D) is a 43 kDa member of the collectin family of innate immune modulators. Its principal components consist of a collagen-like region and a C-terminal carbohydrate recognition domain (CRD), a structure that places it in a subset of pattern recognition proteins termed defense collagens. SP-D is constitutively secreted by alveolar lining cells and epithelium associated with tubular structures and induced in cardiac smooth muscle and endothelial cells. It binds both secreted and transmembrane proteins that transduce its function. It binds human neutrophil defensins, modulating influenza anti-viral defense. It binds MD-2/LY96, a secreted protein that cooperates with Toll-like receptors (TLRs) in the response of macrophages to bacterial lipopolysaccharides (LPS) or cell wall components. It also binds macrophage CD14 and TLRs directly, blocking binding of LPS and down-regulating TNF-a secretion. SP-D binding of both SIRPa and the calreticulin/CD91 complex on macrophages allows for a graded response to environmental challenge.

Product Specifications

Gene Name

SFTPD

Gene ID

6441

UniProt

P35247

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEFVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Zfp120 shRNA (UAS) - Lentiviral mouse Zfp120 shRNA (UAS, RFP) plasmid
GTR15264901 1 Vial

Lentiviral mouse Zfp120 shRNA (UAS) - Lentiviral mouse Zfp120 shRNA (UAS, RFP) plasmid

Ask
View Details
Rat CXCR3 Alexa Fluor 350 MAb (Clone 868013R)
FAB8109RU-100UG 100 µg

Rat CXCR3 Alexa Fluor 350 MAb (Clone 868013R)

Ask
View Details
TARBP2 AAV siRNA Pooled Vector
46125161 1.0 µg

TARBP2 AAV siRNA Pooled Vector

Ask
View Details
Human RHEX Recombinant Protein (N-His)
HD337012-01 50 µg

Human RHEX Recombinant Protein (N-His)

Ask
View Details
Human RHEX Recombinant Protein (N-His)
HD337012-02 100 µg

Human RHEX Recombinant Protein (N-His)

Ask
View Details
Human RHEX Recombinant Protein (N-His)
HD337012-03 1 mg

Human RHEX Recombinant Protein (N-His)

Ask
View Details