Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serpin A1/alpha-1-Antitrypsin (C-6His)

Source: Human Cells. MW :45.35kD. Recombinant Human Serpin A1 is produced by our Mammalian expression system and the target gene encoding Glu25-Lys418 is expressed with a 6His tag at the C-terminus. Serpin A1 is a prototype member of the Serpin superfamily of the serine protease inhibitors. As one of the most abundant proteinase inhibitors in the circulation, it is synthesized in hepatocytes, and to a lesser extent, in macrophages as well as intestinal epithelial cell lines and secreted as the abundant proteinase inhibitor in the circulation whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. Point mutations in the native SerpinA1 variants result in Serpin A1 deficiency, and consequently lead to several clinical complications such as pulmonary emphysema, juvenile hepatitis, cirrhosis, and hepatocellular carcinoma. For example, the Z variants (Glu342 to Lys) forms intracellular inclusion bodies, is not secreted, and leads to a severe SerpinA1 deficiency. Accordingly, Serpin A1 deficiency in circulation is associated with emphysema or liver disease.

Product Specifications

Gene Name

SERPINA1

Gene ID

5265

UniProt

P01009

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM CaCl2, pH 7.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQKVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human ABT1 ELISA KIT
EF007547 96 Tests

Human ABT1 ELISA KIT

Ask
View Details
PPM1A (PPPM1A, Protein Phosphatase 1A, Protein Phosphatase 2C Isoform alpha, Protein Phosphatase IA, FLJ42306, MGC9201, PP2C-ALPHA, PP2CA) (FITC)
MBS6148996-01 0.1 mL

PPM1A (PPPM1A, Protein Phosphatase 1A, Protein Phosphatase 2C Isoform alpha, Protein Phosphatase IA, FLJ42306, MGC9201, PP2C-ALPHA, PP2CA) (FITC)

Ask
View Details
PPM1A (PPPM1A, Protein Phosphatase 1A, Protein Phosphatase 2C Isoform alpha, Protein Phosphatase IA, FLJ42306, MGC9201, PP2C-ALPHA, PP2CA) (FITC)
MBS6148996-02 5x 0.1 mL

PPM1A (PPPM1A, Protein Phosphatase 1A, Protein Phosphatase 2C Isoform alpha, Protein Phosphatase IA, FLJ42306, MGC9201, PP2C-ALPHA, PP2CA) (FITC)

Ask
View Details
Lentiviral mouse Wrap53 shRNA (UAS) - Lentiviral mouse Wrap53 shRNA (UAS, RFP) (100)
GTR15199188 1 Vial

Lentiviral mouse Wrap53 shRNA (UAS) - Lentiviral mouse Wrap53 shRNA (UAS, RFP) (100)

Ask
View Details
Regulator Of Calcineurin 1 Rabbit Monoclonal Antibody [KD Validation]
E51K2543 40 µL

Regulator Of Calcineurin 1 Rabbit Monoclonal Antibody [KD Validation]

Ask
View Details