Recombinant Human Podoplanin/PDPN/Aggrus (C-6His)
Source: Human Cells. MW :12.16kD. Recombinant Human Podoplanin is produced by our Mammalian expression system and the target gene encoding Ala23-Leu131 is expressed with a 6His tag at the C-terminus. Podoplanin is a type-1 transmembrane protein that belongs to Podoplanin family. PDPN expressed in various specialized cell types throughout the body. It highly expressed in placenta, lung, skeletal muscle and brain, weakly expressed in brain, kidney and liver. In placenta, PDPN expressed on the apical plasma membrane of endothelium, in lung, expressed in alveolar epithelium. PDPN physiological function is related to its mucin-type character. PDPN may be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, and major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It requires for normal lung cell proliferation and alveolus formation at birth and Induces platelet aggregation. Nevertheless, it doesnâ€TMt have any effect on amino acid transport and the aquaporin-type water channels.
Product Specifications
Gene Name
PDPN
Gene ID
10630
UniProt
Q86YL7
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVDHHHHHH
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog