Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oxidized Low-Density Lipoprotein Receptor 1/OLR1 (C-6His)

Source: Human Cells. MW :25.39kD. Recombinant Human LOX-1 is produced by our Mammalian expression system and the target gene encoding Ser61-Gln273 is expressed with a 6His tag at the C-terminus. Oxidized Low-Density Lipoprotein Receptor 1 (Ox-LDL Receptor 1) is a secreted, single-pass type II membrane protein which belongs to the C-type lectin superfamily. Ox-LDL Receptor 1 is expressed at high levels in endothelial cells and vascular-rich organs such as placenta, lung, liver, brain, aortic intima, bone marrow, spinal cord and substantia nigra. The expression of Ox-LDL Receptor 1 is induced by inflammatory cytokines such as TNF, IFNG and IL6 by pathological conditions, such as hyperlipidemia, hypertension and diabetes mellitus. Ox-LDL Receptor 1 mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (OxLDL) by vascular endothelial cells. Ox-LDL Receptor 1 association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. Ox-LDL Receptor 1 also binds to oxLDL, which acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. It also participates in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation.

Product Specifications

Gene Name

OLR1

Gene ID

4973

UniProt

P78380

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

3-Cyclohexylpropanal
268843-01 1 g

3-Cyclohexylpropanal

Ask
View Details
3-Cyclohexylpropanal
268843-02 2 g

3-Cyclohexylpropanal

Ask
View Details
3-Cyclohexylpropanal
268843-03 5 g

3-Cyclohexylpropanal

Ask
View Details
Integral Membrane Protein GPR175 (GPR175) Antibody
abx015315-01 10 µg

Integral Membrane Protein GPR175 (GPR175) Antibody

Ask
View Details
Integral Membrane Protein GPR175 (GPR175) Antibody
abx015315-02 100 µg

Integral Membrane Protein GPR175 (GPR175) Antibody

Ask
View Details
Integral Membrane Protein GPR175 (GPR175) Antibody
abx015315-03 200 µg

Integral Membrane Protein GPR175 (GPR175) Antibody

Ask
View Details