Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ephrin A Receptor 7/EphA7 (C-6His)

Source: Human Cells. MW :60.19kD. Recombinant Human Ephrin A Receptor 7 is produced by our Mammalian expression system and the target gene encoding Gln28-Ile556 is expressed with a 6His tag at the C-terminus. Ephrin Type-A Receptor 7 (EPHA7) is a single-pass type I membrane protein which belongs to the Eph family of transmembrane receptor tyrosine kinases. It contains two fibronectin type-III domains, one protein kinase domain and one SAM (sterile alpha motif) domain. EPHA7 is a receptor for members of the ephrin-A family. Eph receptors are largely expressed throughout the ectoderm, mesoderm, and endoderm of vertebrate embryos. EPHA7 functions as a repulsive guidance molecule during the targeting of retinal axons to the superior colliculus and of neocortical axons to the thalamus. EPHA7 is expressed at a substantial level in most human lung cancers. The high expression of EPHA7 protein may participate in the malignancy transformation, invasion progression and metastasis of primary hepatocellular carcinoma. EPHA7 may involve in smoking related lung carcinogenesis.

Product Specifications

Gene Name

EPHA7

Gene ID

2045

UniProt

Q15375

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHSFSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMFEATAVSSEQNPVIVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human HEXIM2 Pre-designed siRNA Set A
SI007032A 1 Each

Human HEXIM2 Pre-designed siRNA Set A

Ask
View Details
Hepatitis C virus test in whole blood
C2203 40 Tests

Hepatitis C virus test in whole blood

Ask
View Details
Nicotinic Acetylcholine Receptor alpha 7 Peptide
MBS544021-01 0.25 mg

Nicotinic Acetylcholine Receptor alpha 7 Peptide

Ask
View Details
Nicotinic Acetylcholine Receptor alpha 7 Peptide
MBS544021-02 5x 0.25 mg

Nicotinic Acetylcholine Receptor alpha 7 Peptide

Ask
View Details
Recombinant Glutathione S Transferase Theta 1 (GSTt1)
MBS2030778-01 0.01 mg

Recombinant Glutathione S Transferase Theta 1 (GSTt1)

Ask
View Details
Recombinant Glutathione S Transferase Theta 1 (GSTt1)
MBS2030778-02 0.05 mg

Recombinant Glutathione S Transferase Theta 1 (GSTt1)

Ask
View Details