Recombinant Human C-C Motif Chemokine 3-Like 1/CCL3L1 (C-6His)
Source: Human Cells. MW :8.82kD. Recombinant Human C-C Motif Chemokine 3-Like 1 is produced by our Mammalian expression system and the target gene encoding Ala24-Ala93 is expressed with a 6His tag at the C-terminus. C-C Motif Chemokine 3-Like 1 (CCL3L1) is a secreted protein that belongs to the intercrine beta (chemokine CC) family. CCL3L1 is a ligand for CCR1, CCR3 and CCR5. CCL3L1 binds to several chemokine receptors including chemokine binding protein 2 and chemokine (C-C motif) receptor 5 (CCR5) . CCR5 is a co-receptor for HIV, and binding of this protein to CCR5 inhibits HIV entry. The processed form LD78-beta (3-70) shows a 20-fold to 30-fold higher chemotactic activity and is a very potent inhibitor of HIV-1-infection. The copy number of this gene varies among individuals: most individuals have 1-6 copies in the diploid genome, although rare individuals have zero or more than six copies. The human genome reference assembly contains two full copies of the gene (CCL3L3 and CCL3L1) and a partial pseudogene. This record represents the more centromeric full-length gene.
Product Specifications
Gene Name
CCL3L1
Gene ID
414062
UniProt
P16619
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLEPSAVDHHHHHH
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog