Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human beta-1,4-Galactosyltransferase 4/B4GALT4 (C-6His)

Source: Human Cells. MW :36.77kD. Recombinant Human B4GALT4 is produced by our Mammalian expression system and the target gene encoding Gln39-Ala344 is expressed with a 6His tag at the C-terminus. beta-1,4-galactosyltransferase 4 (B4GALT4) is a single-pass type II membrane protein that belongs to the Glycosyltransferase 7 family. B4GALT4 consist of the following 2 domains: N-Acetyllactosamine Synthase and beta-N-Acetylglucosaminyl-Glycolipid beta-1,4-Galactosyltransferase. B4GALT4 is highly expressed in the heart, placenta, kidney, and pancreas; it is lowly expressed in the brain, colon, lung, muscle, ovary, testis, and uterus. B4GALT4 function is responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids.

Product Specifications

Gene Name

B4GALT4

Gene ID

8702

UniProt

O60513

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPEECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGAVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Csrp1 (NM_017148) Rat Tagged Lenti ORF Clone
RR203763L4 10 µg

Csrp1 (NM_017148) Rat Tagged Lenti ORF Clone

Ask
View Details
ZADH1 (PTGR2) Rabbit Polyclonal Antibody
TA338852 100 µL

ZADH1 (PTGR2) Rabbit Polyclonal Antibody

Ask
View Details
BPIL2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-8424R-BF647 100 µL

BPIL2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Ask
View Details
6-bromo-8-fluoro-1,2,3,4-tetrahydroisoquinoline
JH913626 1 Each

6-bromo-8-fluoro-1,2,3,4-tetrahydroisoquinoline

Ask
View Details
NPHS1 discontinued
392314 200 µL

NPHS1 discontinued

Ask
View Details