Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein A1/ApoA1 (C-6His)

Source: Human Cells. MW :30kD. Recombinant Human Apolipoprotein A-I is produced by our Mammalian expression system and the target gene encoding Arg19-Gln267 is expressed with a 6His tag at the C-terminus. Apolipoprotein A1 (APOA1) is a secreted protein which belongs to the Apolipoprotein A1/A4/E family. APOA1 is the major protein component of high density lipoprotein (HDL) in plasma. APOA1 plays a critical role in various biological processes, such as Cholesterol metabolism, Lipid metabolism and transport, Steroid metabolism. APOA1 promotes cholesterol efflux from tissues to the liver and thus helps to clear cholesterol from arteries. Defects in this gene resulted in HDL deficiencies, including Tangier disease (TGD), systemic non-neuropathic amyloidosis, premature coronary artery disease, hepatosplenomegaly and progressive muscle wasting and weakness. In addition, ApoA-I is implicated in the anti-endotoxin function of HDL via interaction with lipopolysaccharide or endotoxin.

Product Specifications

Gene Name

APOA1

Gene ID

335

UniProt

P02647

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

2-Amino-4-chlorobenzotrifluoride
TRC-A595415-500MG 500 mg

2-Amino-4-chlorobenzotrifluoride

Ask
View Details
SIGMAR1 ORF Vector (Human) (pORF)
43781012 1.0 µg DNA

SIGMAR1 ORF Vector (Human) (pORF)

Ask
View Details
SLC30A10 CRISPRa sgRNA lentivector (set of three targets)(Human)
44110121 3x 1.0µg DNA

SLC30A10 CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
MAGEA10 Polyclonal Antibody, HRP Conjugated
bs-6816R-HRP 100 µL

MAGEA10 Polyclonal Antibody, HRP Conjugated

Ask
View Details
PerCP anti-human CD14
GT14826 25 Tests

PerCP anti-human CD14

Ask
View Details
Rabbit Polyclonal ASC/TMS1 Antibody [DyLight 550]
NBP1-78977R 0.1 mL

Rabbit Polyclonal ASC/TMS1 Antibody [DyLight 550]

Ask
View Details