Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TREM-1/CD354 (C-6His)

Source: Human Cells. MW :21.3kD. Recombinant Human TREM-1 is produced by our Mammalian expression system and the target gene encoding Ala21-Arg200 is expressed with a 6His tag at the C-terminus. Triggering Receptor Expressed on Myeloid Cells 1 (TREM-1) is a transmembrane protein with a single Ig-like domain. TREM-1 associates with the adapter protein, DAP12, to deliver an activating signal. TREM-1 is expressed on blood neutrophils and monocytes, and the expression is up-regulated by bacterial LPS. TREM-1 is expressed at high levels on neutrophils of patients with microbial sepsis and in mice with a TREM-1/Fc fusion protein protected mice against LPS-induced shock. Human TREM-1 shares 42% sequence homology with mouse TREM-1.

Product Specifications

Gene Name

TREM1

Gene ID

54210

UniProt

Q9NP99

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GATA2 (Phospho-Ser401) Antibody
abx012483-01 10 µg

GATA2 (Phospho-Ser401) Antibody

Ask
View Details
GATA2 (Phospho-Ser401) Antibody
abx012483-02 100 µg

GATA2 (Phospho-Ser401) Antibody

Ask
View Details
GATA2 (Phospho-Ser401) Antibody
abx012483-03 200 µg

GATA2 (Phospho-Ser401) Antibody

Ask
View Details
GATA2 (Phospho-Ser401) Antibody
abx012483-04 300 µg

GATA2 (Phospho-Ser401) Antibody

Ask
View Details
GATA2 (Phospho-Ser401) Antibody
abx012483-05 1 mg

GATA2 (Phospho-Ser401) Antibody

Ask
View Details
anti-ALDH5A1
YF-PA15489 50 ug

anti-ALDH5A1

Ask
View Details