Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tryptase beta-2/TPSB2 (C-6His)

Source: Human Cells. MW :29.64kD. Recombinant Human Tryptase beta-2 is produced by our Mammalian expression system and the target gene encoding Ala19-Pro275 is expressed with a 6His tag at the C-terminus. Tryptases are Trypsin-like Serine Proteases. beta-Tryptases are the main isoenzymes in mast cells. b tryptases form active tetramers with heparin proteoglycan. In the tetramer, the unique arrangement of the active sites facing a narrow central pore, beta-Tryptases are resistant to macromolecule protease inhibitors . When mast cells are activated, beta-Tryptases are released and participate in provoking inflammatory conditions . beta-Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic disorders.

Product Specifications

Gene Name

TPSB2

Gene ID

64499

UniProt

P20231

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

APAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKPVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Polymyxin B-sulfate, Powder
P06-10001P 1 g

Polymyxin B-sulfate, Powder

Ask
View Details
APC-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)
MBS2165475-01 0.1 mL

APC-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)

Ask
View Details
APC-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)
MBS2165475-02 0.2 mL

APC-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)

Ask
View Details
APC-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)
MBS2165475-03 0.5 mL

APC-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)

Ask
View Details
APC-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)
MBS2165475-04 1 mL

APC-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)

Ask
View Details
APC-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)
MBS2165475-05 5 mL

APC-Linked Monoclonal Antibody to Transforming Growth Factor Beta 1 (TGFb1)

Ask
View Details