Recombinant Human Sulfatase Modifying Factor 1/SUMF1 (C-6His)

Source: Human Cells. MW :38.27kD. Recombinant Human SUMF1 is produced by our Mammalian expression system and the target gene encoding Ser34-Asp374 is expressed with a 6His tag at the C-terminus. Human Sulfatase Modifying Factor 1 (SUMF1) is a 42kDa protein. SUMF1 is a Ca2+-binging member of the sulfatase-modifying factor family. SUMF1 is a soluble ER lumenal glycoprotein, it converts inactive sulfatases into an active form by transforming a catalytic site cysteine into a formylglycine residue. In the ER, SUMF1 can exist as either a monomer, or a disulfide-linked homodimer or a heterodimer with SUMF2. Three splice isoforms are known.

Product Specifications

Gene Name

SUMF1

Gene ID

285362

UniProt

Q8NBK3

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM CaCl2, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMDVDHHHHHH