Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfatase Modifying Factor 1/SUMF1 (C-6His)

Source: Human Cells. MW :38.27kD. Recombinant Human SUMF1 is produced by our Mammalian expression system and the target gene encoding Ser34-Asp374 is expressed with a 6His tag at the C-terminus. Human Sulfatase Modifying Factor 1 (SUMF1) is a 42kDa protein. SUMF1 is a Ca2+-binging member of the sulfatase-modifying factor family. SUMF1 is a soluble ER lumenal glycoprotein, it converts inactive sulfatases into an active form by transforming a catalytic site cysteine into a formylglycine residue. In the ER, SUMF1 can exist as either a monomer, or a disulfide-linked homodimer or a heterodimer with SUMF2. Three splice isoforms are known.

Product Specifications

Gene Name

SUMF1

Gene ID

285362

UniProt

Q8NBK3

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM CaCl2, 10% Glycerol, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMDVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMIM29 (NM_001008703) Human Over-expression Lysate
LC423352 20 µg

SMIM29 (NM_001008703) Human Over-expression Lysate

Sign In for Pricing
View Details
FES (NM_001143785) Human Over-expression Lysate
LY428346 100 µg

FES (NM_001143785) Human Over-expression Lysate

Sign In for Pricing
View Details
ZYG11A Human Gene Knockout Kit (CRISPR)
KN429364 1 Kit

ZYG11A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Amino-2,5-dichlorobenzoic Acid
TRC-A605273-2.5G 2.5 g

3-Amino-2,5-dichlorobenzoic Acid

Sign In for Pricing
View Details
Nfasc (1066-1174) Mouse Monoclonal Antibody [Clone ID: L11A/41]
75-027 100 µL

Nfasc (1066-1174) Mouse Monoclonal Antibody [Clone ID: L11A/41]

Sign In for Pricing
View Details
Tylvalosin Tartrate (>80%)
TRC-T634280-500MG 500 mg

Tylvalosin Tartrate (>80%)

Sign In for Pricing
View Details