Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human beta-Galactoside a-2,6-Sialyltransferase 1/ST6GAL1 (C-6His)

Source: Human Cells. MW :44.6kD. Recombinant Human ST6GAL1 is produced by our Mammalian expression system and the target gene encoding Lys27-Cys406 is expressed with a 6His tag at the C-terminus. The ST6GAL1 gene encodes beta-Galactosamide a-2,6-Sialyltransferase 1. It is a type II membrane protein and is localized to the trans-Golgi network. It catalyzes 2,6-sialylation of Gal beta1,4-GlcNAc structures on N-glycans. ST6GAL1 is highly expressed in the liver and other tissues. ST6GAL1 deficiency causes abnormalities in B-cell immunoreactivity. The expression and activity of ST6GAL1 are associated with tumor metastasis in breast and colon cancers. The majority of ST6GAL1 in the liver is cleaved and secreted into the serum and may be used as a biomarker for hepatitis diseases.

Product Specifications

Gene Name

ST6GAL1

Gene ID

6480

UniProt

P15907

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHCVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RLBP1L1 CRISPR Knock Out 293T Cell Line (Human)
39620141 1x 10^6 Cells / 1.0 mL

RLBP1L1 CRISPR Knock Out 293T Cell Line (Human)

Ask
View Details
Mouse Eif1ad2 activation kit by CRISPRa
GA217759 1 Kit

Mouse Eif1ad2 activation kit by CRISPRa

Ask
View Details
DFNA5 / GSDME Recombinant Rabbit monoclonal Antibody
HA723251 100 µL

DFNA5 / GSDME Recombinant Rabbit monoclonal Antibody

Ask
View Details
Dmxl2 Mouse shRNA Plasmid (Locus ID 235380)
TL519727 1 Kit

Dmxl2 Mouse shRNA Plasmid (Locus ID 235380)

Ask
View Details