Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human beta-Galactoside a-2,6-Sialyltransferase 1/ST6GAL1 (C-6His)

Source: Human Cells. MW :44.6kD. Recombinant Human ST6GAL1 is produced by our Mammalian expression system and the target gene encoding Lys27-Cys406 is expressed with a 6His tag at the C-terminus. The ST6GAL1 gene encodes beta-Galactosamide a-2,6-Sialyltransferase 1. It is a type II membrane protein and is localized to the trans-Golgi network. It catalyzes 2,6-sialylation of Gal beta1,4-GlcNAc structures on N-glycans. ST6GAL1 is highly expressed in the liver and other tissues. ST6GAL1 deficiency causes abnormalities in B-cell immunoreactivity. The expression and activity of ST6GAL1 are associated with tumor metastasis in breast and colon cancers. The majority of ST6GAL1 in the liver is cleaved and secreted into the serum and may be used as a biomarker for hepatitis diseases.

Product Specifications

Gene Name

ST6GAL1

Gene ID

6480

UniProt

P15907

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHCVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CACNG7 (Voltage-dependent Calcium Channel gamma-7 Subunit, Neuronal Voltage-gated Calcium Channel gamma-7 Subunit, Transmembrane AMPAR Regulatory Protein gamma-7) (MaxLight 650)
124225-ML650 100 µL

CACNG7 (Voltage-dependent Calcium Channel gamma-7 Subunit, Neuronal Voltage-gated Calcium Channel gamma-7 Subunit, Transmembrane AMPAR Regulatory Protein gamma-7) (MaxLight 650)

Ask
View Details
Human CD19 Protein, Fc Tag
KMPH6039 20 µg

Human CD19 Protein, Fc Tag

Ask
View Details
PAX5 Antibody
V7996-100UG 100 µg

PAX5 Antibody

Ask
View Details
Rabbit Monoclonal Ataxin-3 Antibody
NBP3-33328-100ul 100 µL

Rabbit Monoclonal Ataxin-3 Antibody

Ask
View Details
Suppressor of RNA-mediated gene silencing Antibody
MBS7153300 Inquire

Suppressor of RNA-mediated gene silencing Antibody

Ask
View Details