Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human VEGF-D/FIGF (C-6His)

Source: Human Cells. MW :12.18kD. Recombinant Human Vascular Endothelial Growth Factor D is produced by our Mammalian expression system and the target gene encoding Phe93-Ser201 is expressed with a 6His tag at the C-terminus. Vascular endothelial growth factor D (VEGF-D) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. It is highly expressed in lung, heart, small intestine and fetal lung, and at lower levels in skeletal muscle, colon, and pancreas. VEGF-D is growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. It may function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. It undergoes a complex proteolytic maturation, generating multiple processed forms that bind and activate VEGFR-2 and VEGFR-3 receptors.

Product Specifications

Gene Name

VEGFD

Gene ID

2277

UniProt

O43915

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FBXO10 siRNA (Human)
MBS8215971-01 15 nmol

FBXO10 siRNA (Human)

Ask
View Details
FBXO10 siRNA (Human)
MBS8215971-02 30 nmol

FBXO10 siRNA (Human)

Ask
View Details
FBXO10 siRNA (Human)
MBS8215971-03 5x 30 nmol

FBXO10 siRNA (Human)

Ask
View Details
Porcine IL-5 Affinity Purified Polyclonal Ab
AF3137-SP 25 µg

Porcine IL-5 Affinity Purified Polyclonal Ab

Ask
View Details
PPP1R13B Antibody, HRP conjugated
A65440-50UG 50 µg

PPP1R13B Antibody, HRP conjugated

Ask
View Details
Human Herpes Virus Type 6, p150 (HHV-6 p150) (MaxLight 550) discontinued
171590-ML550 100 µL

Human Herpes Virus Type 6, p150 (HHV-6 p150) (MaxLight 550) discontinued

Ask
View Details