Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neurexophilin-1/NXPH1 (C-6His)

Source: Human Cells. MW :29.67kD. Recombinant Human Neurexophilin-1 is produced by our Mammalian expression system and the target gene encoding Ala22-Gly271 is expressed with a 6His tag at the C-terminus. Neurexophilin-1 (NXPH1) is a member of Neurexophilin family. NXPH1 consist of 271 amino acis. It contains a 21 amino acid signal peptide, 86 amino acid propeptide, and 164 amino acid mature protein. NXPH1 is expressed in subpopulations of neurons within the cerebral cortex, cerebellum and olfactory bulb that are thought to be inhibitory interneurons. In humans, NXPH2 and NXPH3 are most similar to NXPH1, sharing 84% and 64% aa identity within the mature region, respectively. By contrast, NXPH4 dost not bind a-neurexins. Genetic deletion of NXPH1 or NXPH3 produces no anatomical effect.

Product Specifications

Gene Name

NXPH1

Gene ID

30010

UniProt

P58417

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSGVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CSNK1G2 (NM_001319) Human Tagged ORF Clone Lentiviral Particle
RC202145L1V 200 µL

CSNK1G2 (NM_001319) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
SuperECL™ Western Blotting Detection Kit (2x 250ml)
M0013-25 2x 250 mL

SuperECL™ Western Blotting Detection Kit (2x 250ml)

Ask
View Details
3'-Deoxy-3'-amino-ATP sodium
MF-0056692-01 100 mg

3'-Deoxy-3'-amino-ATP sodium

Ask
View Details
3'-Deoxy-3'-amino-ATP sodium
MF-0056692-02 250 mg

3'-Deoxy-3'-amino-ATP sodium

Ask
View Details
3'-Deoxy-3'-amino-ATP sodium
MF-0056692-03 50 mg

3'-Deoxy-3'-amino-ATP sodium

Ask
View Details
KRAS antibody (FITC)
MBS5310311-01 0.1 mg

KRAS antibody (FITC)

Ask
View Details