Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mannose-Binding Protein C/MBL-2/MBP- C (C-6His)

Source: Human Cells. MW :25.06kD. Recombinant Human Mannose Binding Lectin 2 is produced by our Mammalian expression system and the target gene encoding Glu21-Ile248 is expressed with a 6His tag at the C-terminus. Mannose-Binding Protein C (MBP-C) belongs to the Collectin family of innate immune defense proteins. MBL binds to an array of carbohydrate patterns on pathogen surfaces. Collectin family members share common structural features: a cysteine rich amino-terminal domain, a collagen-like region, an a-helical coiled-coil neck domain and a carboxy terminal C-type Lectin or carbohydrate recognition domain (CRD) . MBL homotrimerizes to form a structural unit joined by N-terminal disulfide bridges. These homotrimers further associates into oligomeric structures of up to 6 units. Whereas two forms of MBL proteins exist in rodents and other animals. Human MBL-2 is 25 kDa. Human MBL-2 is a secreted glycoprotein that is synthesized as a 248 amino acid (aa) precursor that contains a 20 aa signal sequence, a 21 aa cysteine-rich region, a 58 aa collagen-like segment and a 111 aa C-type lectin domain that binds to neutral bacterial carbohydrates.

Product Specifications

Gene Name

MBL2

Gene ID

4153

UniProt

P11226

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Threhalose, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPIVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF281 Antibody
MBS8593817-01 0.1 mg

ZNF281 Antibody

Ask
View Details
ZNF281 Antibody
MBS8593817-02 0.1 mL (AF405L)

ZNF281 Antibody

Ask
View Details
ZNF281 Antibody
MBS8593817-03 0.1 mL (AF405S)

ZNF281 Antibody

Ask
View Details
ZNF281 Antibody
MBS8593817-04 0.1 mL (AF610)

ZNF281 Antibody

Ask
View Details
ZNF281 Antibody
MBS8593817-05 0.1 mL (AF635)

ZNF281 Antibody

Ask
View Details
ZNF281 Antibody
MBS8593817-06 0.1 mL (APC)

ZNF281 Antibody

Ask
View Details