Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ly6/PLAUR Domain-Containing Protein 3/LYPD3/C4.4A (C-6His)

Source: Human Cells. MW :27.89kD. Recombinant Human LYPD3 is produced by our Mammalian expression system and the target gene encoding Leu31-His286 is expressed with a 6His tag at the C-terminus. Ly6/PLAUR domain containing3 (LYPD-3) is a GPI-linked protein. The structure of LYPD-3 is similar to the urokinasetype plasminogen activator receptor (uPAR) . LYPD-3 is a 6 -100 kDa molecule with variable cell type-specific N-O-linked glycosylation, mature human LYPD-3 contains two uPAR/Ly6 domains and a Ser/Thr/Pro-rich (STP) region includes a protease sensitive site . The interaction of LYPD-3 with Laminin 1 and 5 on neighboring cells promotes the adhesion, spreading, and migration of tumor cells. LYPD-3 additionally interacts with Galectin-3 and the anterior gradient proteins AG-2 and AG-3. LYPD-3 overexpression in non-small cell lung cancer is predictive of increased mortality.

Product Specifications

Gene Name

LYPD3

Gene ID

27076

UniProt

O95274

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Anti-NCAM-1/CD56 Antibody, Rabbit Monoclonal
MBS8124861-01 0.1 mL

Recombinant Anti-NCAM-1/CD56 Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
Recombinant Anti-NCAM-1/CD56 Antibody, Rabbit Monoclonal
MBS8124861-02 5x 0.1 mL

Recombinant Anti-NCAM-1/CD56 Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details
INTS12 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV678844 1.0 µg DNA

INTS12 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Hamartin, Phosphorylated (Ser505) (TSC1, Tuberous Sclerosis 1 Protein, KIAA0243, TSC) (MaxLight 405)
MBS6479424-01 0.1 mL

Hamartin, Phosphorylated (Ser505) (TSC1, Tuberous Sclerosis 1 Protein, KIAA0243, TSC) (MaxLight 405)

Sign In for Pricing
View Details
Hamartin, Phosphorylated (Ser505) (TSC1, Tuberous Sclerosis 1 Protein, KIAA0243, TSC) (MaxLight 405)
MBS6479424-02 5x 0.1 mL

Hamartin, Phosphorylated (Ser505) (TSC1, Tuberous Sclerosis 1 Protein, KIAA0243, TSC) (MaxLight 405)

Sign In for Pricing
View Details
SMAD5 Antibody
F47574-0.08ML 0.08 mL

SMAD5 Antibody

Sign In for Pricing
View Details