Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kallikrein 1/KLK1 (C-6His)

Source: Human Cells. MW :28.15kD. Recombinant Human Kallikrein 1 is produced by our Mammalian expression system and the target gene encoding Pro19-Ser262 is expressed with a 6His tag at the C-terminus. Kallikrein-1 (KLK1) is a member of human tissue Kallikrein family. Human KLK1 precursor contains a singal peptide (residues 1 to 18), a short pro peptide (residues 19 to 24) and a mature chain (residues 25 to 262) . The function of KLK1 is to cleave Kininogen in order to release the vasoactive Kinin peptide (Lysyl-Bradykinin or Bradykinin) . The Kinin peptide controls blood pressure reduction, vasodilation, smooth muscle relaxation and contraction, pain induction and inflammation. KLK1 also plays a role in angiogensis and tumorigenesis.

Product Specifications

Gene Name

KLK1

Gene ID

3816

UniProt

P06870

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM CaCl2, pH 8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTQEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKVHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENSVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Arg 3.1 (ARC) Mouse Monoclonal Antibody [Clone ID: LBI2B3]
AMM20578VCF 100 µg

Arg 3.1 (ARC) Mouse Monoclonal Antibody [Clone ID: LBI2B3]

Ask
View Details
Recombinant Rhodobacter sphaeroides 3-isopropylmalate dehydratase small subunit (leuD)
MBS1124686-01 0.02 mg (E-Coli)

Recombinant Rhodobacter sphaeroides 3-isopropylmalate dehydratase small subunit (leuD)

Ask
View Details
Recombinant Rhodobacter sphaeroides 3-isopropylmalate dehydratase small subunit (leuD)
MBS1124686-02 0.1 mg (E-Coli)

Recombinant Rhodobacter sphaeroides 3-isopropylmalate dehydratase small subunit (leuD)

Ask
View Details
Recombinant Rhodobacter sphaeroides 3-isopropylmalate dehydratase small subunit (leuD)
MBS1124686-03 0.02 mg (Yeast)

Recombinant Rhodobacter sphaeroides 3-isopropylmalate dehydratase small subunit (leuD)

Ask
View Details
Recombinant Rhodobacter sphaeroides 3-isopropylmalate dehydratase small subunit (leuD)
MBS1124686-04 0.1 mg (Yeast)

Recombinant Rhodobacter sphaeroides 3-isopropylmalate dehydratase small subunit (leuD)

Ask
View Details
Recombinant Rhodobacter sphaeroides 3-isopropylmalate dehydratase small subunit (leuD)
MBS1124686-05 0.02 mg (Baculovirus)

Recombinant Rhodobacter sphaeroides 3-isopropylmalate dehydratase small subunit (leuD)

Ask
View Details