Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coagulation Factor III/Tissue Factor/CD142 (C-6His)

Source: Human Cells. MW :25.76kD. Recombinant Human Coagulation Factor III is produced by our Mammalian expression system and the target gene encoding Gly34-Glu251 is expressed with a 6His tag at the C-terminus. Tissue Factor (TF) is a single-pass type I membrane glycoprotein member of the tissue factor family. TF expression is highly dependent upon cell type. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. TF initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade.

Product Specifications

Gene Name

F3

Gene ID

2152

UniProt

P13726

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Transient receptor potential cation channel subfamily M member 8 (Trpm8) , partial
MBS7094367-01 0.05 mg (E-Coli)

Recombinant Rat Transient receptor potential cation channel subfamily M member 8 (Trpm8) , partial

Sign In for Pricing
View Details
Recombinant Rat Transient receptor potential cation channel subfamily M member 8 (Trpm8) , partial
MBS7094367-02 0.05 mg (Yeast)

Recombinant Rat Transient receptor potential cation channel subfamily M member 8 (Trpm8) , partial

Sign In for Pricing
View Details
Recombinant Rat Transient receptor potential cation channel subfamily M member 8 (Trpm8) , partial
MBS7094367-03 0.2 mg (E-Coli)

Recombinant Rat Transient receptor potential cation channel subfamily M member 8 (Trpm8) , partial

Sign In for Pricing
View Details
Recombinant Rat Transient receptor potential cation channel subfamily M member 8 (Trpm8) , partial
MBS7094367-04 0.5 mg (E-Coli)

Recombinant Rat Transient receptor potential cation channel subfamily M member 8 (Trpm8) , partial

Sign In for Pricing
View Details
Recombinant Rat Transient receptor potential cation channel subfamily M member 8 (Trpm8) , partial
MBS7094367-05 0.05 mg (Baculovirus)

Recombinant Rat Transient receptor potential cation channel subfamily M member 8 (Trpm8) , partial

Sign In for Pricing
View Details
Recombinant Rat Transient receptor potential cation channel subfamily M member 8 (Trpm8) , partial
MBS7094367-06 0.2 mg (Yeast)

Recombinant Rat Transient receptor potential cation channel subfamily M member 8 (Trpm8) , partial

Sign In for Pricing
View Details