Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B7-H2/ICOSLG/CD275 (C-6His)

Source: Human Cells. MW :27.72kD. Recombinant Human Inducible Co-Stimulator Ligand is produced by our Mammalian expression system and the target gene encoding Asp19-Ser258 is expressed with a 6His tag at the C-terminus. Inducible Co-Stimulator Ligand (ICOSLG) belongs to the immunoglobulin superfamily. ICOSLG contains Ig-like C2-type (immunoglobulin-like) domain and 1 Ig-like V-type (immunoglobulin-like) domain. ICOSLG acts as a costimulatory signal for T-cell proliferation and cytokine secretion, it also induces B-cell proliferation and differentiation into plasma cells. It could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function. ICOSLG is widely expressed lymph nodes, leukocytes and spleen, detected on activated monocytes and dendritic cells.

Product Specifications

Gene Name

ICOSLG

Gene ID

102723996

UniProt

O75144

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Prr30 (NM_029680) Mouse Tagged Lenti ORF Clone
MR212541L3 10 µg

Prr30 (NM_029680) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CNTF (HCNTF, Ciliary Neurotrophic Factor) discontinued
210192-01 20 µL

CNTF (HCNTF, Ciliary Neurotrophic Factor) discontinued

Sign In for Pricing
View Details
CNTF (HCNTF, Ciliary Neurotrophic Factor) discontinued
210192-02 100 µL

CNTF (HCNTF, Ciliary Neurotrophic Factor) discontinued

Sign In for Pricing
View Details
Rabbit Anti-LYPD3 antibody
SL18572R-01 50 µL

Rabbit Anti-LYPD3 antibody

Sign In for Pricing
View Details
Rabbit Anti-LYPD3 antibody
SL18572R-02 100 µL

Rabbit Anti-LYPD3 antibody

Sign In for Pricing
View Details
NKIRAS2 Knockout HEK293T Polyclonal Cells
ARG3669 1 Million

NKIRAS2 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details