Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B7-H2/ICOSLG/CD275 (C-6His)

Source: Human Cells. MW :27.72kD. Recombinant Human Inducible Co-Stimulator Ligand is produced by our Mammalian expression system and the target gene encoding Asp19-Ser258 is expressed with a 6His tag at the C-terminus. Inducible Co-Stimulator Ligand (ICOSLG) belongs to the immunoglobulin superfamily. ICOSLG contains Ig-like C2-type (immunoglobulin-like) domain and 1 Ig-like V-type (immunoglobulin-like) domain. ICOSLG acts as a costimulatory signal for T-cell proliferation and cytokine secretion, it also induces B-cell proliferation and differentiation into plasma cells. It could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function. ICOSLG is widely expressed lymph nodes, leukocytes and spleen, detected on activated monocytes and dendritic cells.

Product Specifications

Gene Name

ICOSLG

Gene ID

102723996

UniProt

O75144

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MYLPF (Myosin Regulatory Light Chain 2, Skeletal Muscle Isoform, Fast Skeletal Myosin Light Chain 2, MLC2B, DKFZp779C0757, HUMMLC2B, MGC13450) (MaxLight 650)
MBS6223343-01 0.1 mL

MYLPF (Myosin Regulatory Light Chain 2, Skeletal Muscle Isoform, Fast Skeletal Myosin Light Chain 2, MLC2B, DKFZp779C0757, HUMMLC2B, MGC13450) (MaxLight 650)

Ask
View Details
MYLPF (Myosin Regulatory Light Chain 2, Skeletal Muscle Isoform, Fast Skeletal Myosin Light Chain 2, MLC2B, DKFZp779C0757, HUMMLC2B, MGC13450) (MaxLight 650)
MBS6223343-02 5x 0.1 mL

MYLPF (Myosin Regulatory Light Chain 2, Skeletal Muscle Isoform, Fast Skeletal Myosin Light Chain 2, MLC2B, DKFZp779C0757, HUMMLC2B, MGC13450) (MaxLight 650)

Ask
View Details
Danshenol B
MBS5790968 Inquire

Danshenol B

Ask
View Details
Rabbit anti-Escherichia coli (strain K12) YFDY Polyclonal Antibody
MBS7149316 Inquire

Rabbit anti-Escherichia coli (strain K12) YFDY Polyclonal Antibody

Ask
View Details
NATtrol MRSA/SA Negative Control
NATMSSE-6MC-IVD 6x 0.5 mL

NATtrol MRSA/SA Negative Control

Ask
View Details
Recombinant Pseudomonas putida Phenylacetate-coenzyme A ligase (paaK)
MBS1063090-01 0.02 mg (E-Coli)

Recombinant Pseudomonas putida Phenylacetate-coenzyme A ligase (paaK)

Ask
View Details