Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycoprotein A33/GPA33/GPA33 (C-6His)

Source: Human Cells. MW :24.66kD. Recombinant Human Glycoprotein A33 is produced by our Mammalian expression system and the target gene encoding Ile22-Val235 is expressed with a 6His tag at the C-terminus. Human Glycoprotein A33 (GPA33) is a single-pass type I membrane protein, belongs to the CTX family of cell adhesion molecular within the immunoglobulin family, can be expressed in normal gastrointestinal epithelium and in 95% of colon cancers. GPA33 consists of one Ig-like C2-type domain and one Ig-like V-type domain. The predicted mature protein includes a single transmembrane domain, a extracellular region and a intracellular tail. Intracellular traffic and recycling to the cell surface appear to play an important role in GPA33 function and to have an influence on its surface density superseding translation regulation. GPA33 has become a promising target of immunologic therapy strategies. GPA33 may also play a important role in cell-cell recognition and signaling.

Product Specifications

Gene Name

GPA33

Gene ID

10223

UniProt

Q99795

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNVVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ATP6V1F Mouse Monoclonal Antibody [Clone ID: LBI5F10]
AMM10866V 100 µL

ATP6V1F Mouse Monoclonal Antibody [Clone ID: LBI5F10]

Ask
View Details
Vmn2r96-set siRNA/shRNA/RNAi Lentivector (Mouse)
49843094 4x 500 ng

Vmn2r96-set siRNA/shRNA/RNAi Lentivector (Mouse)

Ask
View Details
NUP93 Antibody - C-terminal region
MBS3216631-01 0.1 mL

NUP93 Antibody - C-terminal region

Ask
View Details
NUP93 Antibody - C-terminal region
MBS3216631-02 5x 0.1 mL

NUP93 Antibody - C-terminal region

Ask
View Details
Sheep UDP Glucuronosyltransferase 1 Family, Polypeptide A1 ELISA Kit
OM621332 96 Strip Well

Sheep UDP Glucuronosyltransferase 1 Family, Polypeptide A1 ELISA Kit

Ask
View Details
Rabbit anti-human sulfotransferase family, cytosolic, 1C, member 2 polyclonal Antibody
MBS714450-01 0.1 mL

Rabbit anti-human sulfotransferase family, cytosolic, 1C, member 2 polyclonal Antibody

Ask
View Details