Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycoprotein A33/GPA33/GPA33 (C-6His)

Source: Human Cells. MW :24.66kD. Recombinant Human Glycoprotein A33 is produced by our Mammalian expression system and the target gene encoding Ile22-Val235 is expressed with a 6His tag at the C-terminus. Human Glycoprotein A33 (GPA33) is a single-pass type I membrane protein, belongs to the CTX family of cell adhesion molecular within the immunoglobulin family, can be expressed in normal gastrointestinal epithelium and in 95% of colon cancers. GPA33 consists of one Ig-like C2-type domain and one Ig-like V-type domain. The predicted mature protein includes a single transmembrane domain, a extracellular region and a intracellular tail. Intracellular traffic and recycling to the cell surface appear to play an important role in GPA33 function and to have an influence on its surface density superseding translation regulation. GPA33 has become a promising target of immunologic therapy strategies. GPA33 may also play a important role in cell-cell recognition and signaling.

Product Specifications

Gene Name

GPA33

Gene ID

10223

UniProt

Q99795

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNVVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BIO-acetoxime
407198 50.0mg

BIO-acetoxime

Ask
View Details
TSPAN5 (NM_005723) Human Tagged ORF Clone Lentiviral Particle
RC202123L4V 200 µL

TSPAN5 (NM_005723) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Rauvoyunine C
HY-N1518 1 Each

Rauvoyunine C

Ask
View Details
Anti-Keratin 10 Antibody (KRT10)
V3181IHC-7ML 7 mL

Anti-Keratin 10 Antibody (KRT10)

Ask
View Details
Human IL-2 R beta Alexa Fluor 405 Antibody (Clone 27302)
FAB224V-100UG 100 µg

Human IL-2 R beta Alexa Fluor 405 Antibody (Clone 27302)

Ask
View Details
Mouse mmu-miR-876-3p miRNA Agomir
abx883081-01 5 nmol

Mouse mmu-miR-876-3p miRNA Agomir

Ask
View Details