Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin a Fc Receptor/FCAR/CD89 (C-6His)

Source: Human Cells. MW :24.52kD. Recombinant Human CD89 is produced by our Mammalian expression system and the target gene encoding Gln22-Asn227 is expressed with a 6His tag at the C-terminus. Immunoglobulin a Fc Receptor (IgA Fc Receptor) is a member of the immunoglobulin gene superfamily. It is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens through the charged arginin residue within its transmembrane domain. IgA Fc Receptor binds both IgA1 and IgA2 with similar affinity. The site of interaction between FCAR and IgA was identified in the first extracellular domain of FCAR and the C2/C3 junction of IgA. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. FCAR is also expressed on Kupffer cells in the liver, where it was suggested to provide a second line of defense.

Product Specifications

Gene Name

FCAR

Gene ID

2204

UniProt

P24071

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQNVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

SNUPN Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV696287 1.0 µg DNA

SNUPN Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Recombinant BMPR-IA Protein (Gln 24-Arg 152) [His]
VAng-1128Lsx-1mg 1 mg

Recombinant BMPR-IA Protein (Gln 24-Arg 152) [His]

Sign In for Pricing
View Details
CK2-IN-4
HY-148328-01 5 mg

CK2-IN-4

Sign In for Pricing
View Details
CK2-IN-4
HY-148328-02 10 mg

CK2-IN-4

Sign In for Pricing
View Details
CK2-IN-4
HY-148328-03 25 mg

CK2-IN-4

Sign In for Pricing
View Details
Mouse Osbp2 Pre-designed siRNA Set B
SI109931B 1 Each

Mouse Osbp2 Pre-designed siRNA Set B

Sign In for Pricing
View Details