Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystatin SN/CST1 (C-6His)

Source: Human Cells. MW :15.35kD. Recombinant Human Cystatin SN is produced by our Mammalian expression system and the target gene encoding Trp21-Ser141 is expressed with a 6His tag at the C-terminus. Cystatin-SN is a member of family 2 of the Cystatin superfamily and a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid. Together with Cystatins S and SA, it is produced by the salivary gland and secreted largely in the submandibular/sublingual saliva. Cystatin-SN inhibits members of the Papain family including Cathepsins B, C, H and L.

Product Specifications

Gene Name

CST1

Gene ID

1469

UniProt

P01037

Components

Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQESVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DKK1 (Dickkopf Homolog 1 (Xenopus laevis), DKK-1, SK) (FITC)
245365-FITC 100 µL

DKK1 (Dickkopf Homolog 1 (Xenopus laevis), DKK-1, SK) (FITC)

Ask
View Details
CD20, CT (MS4A1, B1, S7, Bp35, MS4A2, LEU-16, MGC3969, membrane-spanning 4-domains, subfamily A, member 1, B-lymphocyte cell-surface antigen B1)
C2270-05H 100 µg

CD20, CT (MS4A1, B1, S7, Bp35, MS4A2, LEU-16, MGC3969, membrane-spanning 4-domains, subfamily A, member 1, B-lymphocyte cell-surface antigen B1)

Ask
View Details
SEPT1 (Septin-1, LARP, Peanut-like Protein 3, Serologically Defined Breast Cancer Antigen NY-BR-24, DIFF6, PNUTL3) (FITC)
MBS6149579-01 0.1 mL

SEPT1 (Septin-1, LARP, Peanut-like Protein 3, Serologically Defined Breast Cancer Antigen NY-BR-24, DIFF6, PNUTL3) (FITC)

Ask
View Details
SEPT1 (Septin-1, LARP, Peanut-like Protein 3, Serologically Defined Breast Cancer Antigen NY-BR-24, DIFF6, PNUTL3) (FITC)
MBS6149579-02 5x 0.1 mL

SEPT1 (Septin-1, LARP, Peanut-like Protein 3, Serologically Defined Breast Cancer Antigen NY-BR-24, DIFF6, PNUTL3) (FITC)

Ask
View Details
Mouse Monoclonal CXCR7/RDC-1 Antibody (896032R) [DyLight 650]
FAB8399RW 0.1 mL

Mouse Monoclonal CXCR7/RDC-1 Antibody (896032R) [DyLight 650]

Ask
View Details
DSN1, CT (DSN1, C20orf172, MIS13, Kinetochore-associated protein DSN1 homolog) (Azide free) (HRP)
MBS6293602-01 0.2 mL

DSN1, CT (DSN1, C20orf172, MIS13, Kinetochore-associated protein DSN1 homolog) (Azide free) (HRP)

Ask
View Details