Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathepsin L2/CTSL2 (C-6His)

Source: Human Cells. MW :36.69kD. Recombinant Human Cathepsin L2 is produced by our Mammalian expression system and the target gene encoding Val18-Val334 is expressed with a 6His tag at the C-terminus. Cathepsin L2 belongs to the Peptidase C1 family. Cathepsin L2 can be autocatalytically convertedto the mature form as a proenzyme in lysosomes at pH=7.0. Cathepsin L2 cannot be expressed in normal mammary gland, colon and peritumoral tissue, but it can be expressed in breast carcinomas and colorectal tissues. These suggeats Cathepsin L2 may play a role in tumor processes. Cathepsin L2 is specifically expressed in the testis, thymus, and corneal epithelium.

Product Specifications

Gene Name

CTSV

Gene ID

1515

UniProt

O60911

Components

Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNVVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Anti-p21 antibody (Rabbit mAb)
GB150049-50 50 μL

Recombinant Anti-p21 antibody (Rabbit mAb)

Ask
View Details
N, N-Bis ([1,1′-biphenyl]-4-yl) -3′- (6-phenyl-4-dibenzofuranyl) [1,1′-biphenyl]-4-amine
JH919460 1 Each

N, N-Bis ([1,1′-biphenyl]-4-yl) -3′- (6-phenyl-4-dibenzofuranyl) [1,1′-biphenyl]-4-amine

Ask
View Details