Recombinant Human Placental Lactogen/CSH1 (C-6His)

Source: Human Cells. MW :23.35kD. Recombinant Human Placental Lactogen is produced by our Mammalian expression system and the target gene encoding Val27-Phe217 is expressed with a 6His tag at the C-terminus. Chorionic Somatomammotropin Hormone (CSH1) belongs to the Somatotropin/Prolactin family. It is located at the growth hormone locus on chromosome 17. It is produced by cells in the syncytiotrophoblast layer of the placenta only during pregnancy. Although CSH1 does not interact with GHR but only activates PRLR through zinc-induced dimerization. It is expressed mainly in the placenta and utilizes multiple transcription initiation sites. CSH1 plays an important role in stimulating lactation, growth control and metabolism.

Product Specifications

Gene Name

CSH2

Gene ID

1442

UniProt

P01243

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGFVDHHHHHH