Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CEACAM3/CD66d (C-6His)

Source: Human Cells. MW :14.13kD. Recombinant Human CEACAM3 is produced by our Mammalian expression system and the target gene encoding Lys35-Gly155 is expressed with a 6His tag at the C-terminus. Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3 (CEACAM3) belongs to the immunoglobulin superfamily and CEA family. CEACAM3 was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. CEACAM3 mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. In addition, it is associated with the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses.

Product Specifications

Gene Name

CEACAM3

Gene ID

1084

UniProt

P40198

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Apoptosis-inducing Factor 2 (AIFM2) Mouse ELISA Kit
B6315 96 Tests

Apoptosis-inducing Factor 2 (AIFM2) Mouse ELISA Kit

Ask
View Details
CAPN5 (Calpain-5, Calpain 5, Calpain htra-3, New Calpain 3, nCL-3, NCL3) (MaxLight 750) discontinued
C1035-28E-ML750 100 µL

CAPN5 (Calpain-5, Calpain 5, Calpain htra-3, New Calpain 3, nCL-3, NCL3) (MaxLight 750) discontinued

Ask
View Details
PHF7 (PHD Finger Protein 7, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6) (MaxLight 405)
MBS6197218-01 0.1 mL

PHF7 (PHD Finger Protein 7, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6) (MaxLight 405)

Ask
View Details
PHF7 (PHD Finger Protein 7, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6) (MaxLight 405)
MBS6197218-02 5x 0.1 mL

PHF7 (PHD Finger Protein 7, DKFZp434L1850, HSPC045, HSPC226, MGC26088, NYD-SP6) (MaxLight 405)

Ask
View Details
Crtc2 (NM_028881) Mouse Tagged Lenti ORF Clone
MR210074L4 10 µg

Crtc2 (NM_028881) Mouse Tagged Lenti ORF Clone

Ask
View Details
Anti-human inducible Nitric Oxide Synthase Monoclonal Antibody 21C10-1D10
MBS350037-01 0.1 mL

Anti-human inducible Nitric Oxide Synthase Monoclonal Antibody 21C10-1D10

Ask
View Details