Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CEACAM3/CD66d (C-6His)

Source: Human Cells. MW :14.13kD. Recombinant Human CEACAM3 is produced by our Mammalian expression system and the target gene encoding Lys35-Gly155 is expressed with a 6His tag at the C-terminus. Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3 (CEACAM3) belongs to the immunoglobulin superfamily and CEA family. CEACAM3 was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. CEACAM3 mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. In addition, it is associated with the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses.

Product Specifications

Gene Name

CEACAM3

Gene ID

1084

UniProt

P40198

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Importin alpha 5/KPNA1/SRP1 Protein - (Dry Ice)
H00003836-P01-25ug 25 µg

Recombinant Human Importin alpha 5/KPNA1/SRP1 Protein - (Dry Ice)

Sign In for Pricing
View Details
Lentiviral human GABRR2 shRNA (UAS) - Lentiviral human GABRR2 shRNA (UAS, GFP) (25)
GTR15097196 1 Vial

Lentiviral human GABRR2 shRNA (UAS) - Lentiviral human GABRR2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Np4 3'UTR Luciferase Stable Cell Line
TU214105 1.0 mL

Np4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat PTBP1 ELISA Kit
E094802 1 Each

Rat PTBP1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal BAF180/PB1 Antibody [DyLight 488]
NB100-79832G 0.1 mL

Rabbit Polyclonal BAF180/PB1 Antibody [DyLight 488]

Sign In for Pricing
View Details
Recombinant Human S100A1 Protein (Trx Tag)
PDEH100557-01 20 µg

Recombinant Human S100A1 Protein (Trx Tag)

Sign In for Pricing
View Details