Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CEACAM3/CD66d (C-6His)

Source: Human Cells. MW :14.13kD. Recombinant Human CEACAM3 is produced by our Mammalian expression system and the target gene encoding Lys35-Gly155 is expressed with a 6His tag at the C-terminus. Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3 (CEACAM3) belongs to the immunoglobulin superfamily and CEA family. CEACAM3 was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. CEACAM3 mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. In addition, it is associated with the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses.

Product Specifications

Gene Name

CEACAM3

Gene ID

1084

UniProt

P40198

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF367 shRNA (h) Lentiviral Particles
sc-92777-V 200 µL

ZNF367 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Mouse Immunoglobulin A (IgA) ELISA Development Kit
abx378063-01 5x 96 Tests

Mouse Immunoglobulin A (IgA) ELISA Development Kit

Sign In for Pricing
View Details
Mouse Immunoglobulin A (IgA) ELISA Development Kit
abx378063-02 15x 96 Tests

Mouse Immunoglobulin A (IgA) ELISA Development Kit

Sign In for Pricing
View Details
Anti-Cbx8 Antibody Picoband® Fluoro647 Conjugated
A05234-2-Fluoro647 100 µg/Vial

Anti-Cbx8 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Dlg2 mouse monoclonal antibody, clone N18/30
73-057 5 mL

Dlg2 mouse monoclonal antibody, clone N18/30

Sign In for Pricing
View Details
Triamcinolone Acetonide
S1628-10mM/1mL 10 mM/1mL

Triamcinolone Acetonide

Sign In for Pricing
View Details