Recombinant Human CEACAM3/CD66d (C-6His)
Source: Human Cells. MW :14.13kD. Recombinant Human CEACAM3 is produced by our Mammalian expression system and the target gene encoding Lys35-Gly155 is expressed with a 6His tag at the C-terminus. Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3 (CEACAM3) belongs to the immunoglobulin superfamily and CEA family. CEACAM3 was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. CEACAM3 mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. In addition, it is associated with the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses.
Product Specifications
Gene Name
CEACAM3
Gene ID
1084
UniProt
P40198
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGVDHHHHHH
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog