Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PRV1/CD177 (C-6His)

Source: Human Cells. MW :42.33kD. Recombinant Human CD177 is produced by our Mammalian expression system and the target gene encoding Leu22-Gly407 is expressed with a 6His tag at the C-terminus. CD177 is polymorphic and has at least two alleles: PRV1 and NB1. Human PRV1 is a Glycosyl-Phosphatidylinositol (GPI) -linked cell surface glycoprotein that belongs to the uPAR/CD59/Ly6 family of receptors. PRV1 is expressed by neutrophils and neutrophil precursors, and changes in expression serve as diagnostic markers for myeloproliferative disorders such as polycythemia vera and essential thrombocythemia. PRV1 may also be expressed by Erythroblasts, B cells, and Monocytes. NB1, a Glycosyl-Phosphatidylinositol (GPI) -linked cell surface glycoprotein, was first described in a case of neonatal alloimmune neutropenia. It is reported that CD177 functions as a novel heterophilic binding partner that engages PECAM-1 in membrane-proximal IgD6.

Product Specifications

Gene Name

CD177

Gene ID

57126

UniProt

Q8N6Q3

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGTTHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEGVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Utp14b (NM_001001981) Mouse Tagged ORF Clone
MG219393 10 µg

Utp14b (NM_001001981) Mouse Tagged ORF Clone

Ask
View Details
APC_Cy7 Linked Polyclonal Antibody to Histone H4 (H4)
MBS2129129-01 0.1 mL

APC_Cy7 Linked Polyclonal Antibody to Histone H4 (H4)

Ask
View Details
APC_Cy7 Linked Polyclonal Antibody to Histone H4 (H4)
MBS2129129-02 0.2 mL

APC_Cy7 Linked Polyclonal Antibody to Histone H4 (H4)

Ask
View Details
APC_Cy7 Linked Polyclonal Antibody to Histone H4 (H4)
MBS2129129-03 0.5 mL

APC_Cy7 Linked Polyclonal Antibody to Histone H4 (H4)

Ask
View Details
APC_Cy7 Linked Polyclonal Antibody to Histone H4 (H4)
MBS2129129-04 1 mL

APC_Cy7 Linked Polyclonal Antibody to Histone H4 (H4)

Ask
View Details
APC_Cy7 Linked Polyclonal Antibody to Histone H4 (H4)
MBS2129129-05 5 mL

APC_Cy7 Linked Polyclonal Antibody to Histone H4 (H4)

Ask
View Details