Recombinant Human C-C Motif Chemokine 14/CCL14/HCC-3 (C-6His)
Source: Human Cells. MW :9.71kD. Recombinant Human C-C Motif Chemokine 14 is produced by our Mammalian expression system and the target gene encoding Thr20-Asn93 is expressed with a 6His tag at the C-terminus. Chemokine (C-C motif) Ligand 14 (CCL14) is a small cytokine belonging to the CC chemokine family. It is produced as a protein precursor that is processed to generate a mature active protein containing 74 amino acids that and is 46% identical in amino acid composition to CCL3 and CCL4. This chemokine is expressed in various tissues including spleen, bone marrow, liver, muscle, and gut. CCL14 activates monocytes, but does not induce their chemotaxis. Human CCL14 is located on chromosome 17 within a cluster of other chemokines belonging to the CC family.
Product Specifications
Gene Name
CCL14
Gene ID
6358
UniProt
Q16627
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKENVDHHHHHH
Explore Other Products
Browse additional items from our catalog