Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C Motif Chemokine 14/CCL14/HCC-3 (C-6His)

Source: Human Cells. MW :9.71kD. Recombinant Human C-C Motif Chemokine 14 is produced by our Mammalian expression system and the target gene encoding Thr20-Asn93 is expressed with a 6His tag at the C-terminus. Chemokine (C-C motif) Ligand 14 (CCL14) is a small cytokine belonging to the CC chemokine family. It is produced as a protein precursor that is processed to generate a mature active protein containing 74 amino acids that and is 46% identical in amino acid composition to CCL3 and CCL4. This chemokine is expressed in various tissues including spleen, bone marrow, liver, muscle, and gut. CCL14 activates monocytes, but does not induce their chemotaxis. Human CCL14 is located on chromosome 17 within a cluster of other chemokines belonging to the CC family.

Product Specifications

Gene Name

CCL14

Gene ID

6358

UniProt

Q16627

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKENVDHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HHLA2 Antibody
E55A06718 100 µg

Human HHLA2 Antibody

Sign In for Pricing
View Details
KCNS2, NT (KCNS2, KIAA1144, Potassium voltage-gated channel subfamily S member 2, Delayed-rectifier K (+) channel alpha subunit 2, Voltage-gated potassium channel subunit Kv9.2) (APC) discontinued
037348-APC 200 µL

KCNS2, NT (KCNS2, KIAA1144, Potassium voltage-gated channel subfamily S member 2, Delayed-rectifier K (+) channel alpha subunit 2, Voltage-gated potassium channel subunit Kv9.2) (APC) discontinued

Sign In for Pricing
View Details
Human ANKRD49 qPCR Primer Pair
QH43249S 200 Tests

Human ANKRD49 qPCR Primer Pair

Sign In for Pricing
View Details
SariuMab (anti-IL-6Ralpha)
MBS5784879-01 5 mg

SariuMab (anti-IL-6Ralpha)

Sign In for Pricing
View Details
SariuMab (anti-IL-6Ralpha)
MBS5784879-02 5x 5 mg

SariuMab (anti-IL-6Ralpha)

Sign In for Pricing
View Details
Recombinant Human Galectin-1 CF
1152-GA-050/CF 50 µg

Recombinant Human Galectin-1 CF

Sign In for Pricing
View Details