Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathepsin Z/CTSZ (C-6His)

Source: Human Cells. MW :32.51kD. Recombinant Human Cathepsin Z is produced by our Mammalian expression system and the target gene encoding Gly24-Val303 is expressed with a 6His tag at the C-terminus. Cathepsin Z is a lysosomal cysteine proteinase and belongs to the peptidase C1 family. Human Cathepsin Z contains a singnal sequence, a propeptide and a mature chain. It exhibits bothcarboxy-monopeptidase and carboxy-dipeptidase activities. In contrast to cathepsin B, it does not act as an endopeptidase. Cathepsin Z is restricted to the cells of theimmune system, predominantly monocytes, macrophages and dendritic cells. It is expressed ubiquitously in cancer cell lines and primary tumors. Like other members of this family, Cathepsin Z may be involved in tumorigenesis.

Product Specifications

Gene Name

CTSZ

Gene ID

1522

UniProt

Q9UBR2

Components

Supplied as a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIVVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf160 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-9695R-BF680 100 µL

C20orf160 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
VPS24 (CHMP3) (NM_016079) Human Mass Spec Standard
PH320006 10 µg

VPS24 (CHMP3) (NM_016079) Human Mass Spec Standard

Sign In for Pricing
View Details
Papanicolaou Stain, OG-6
GT9653-2500ml 2500 mL

Papanicolaou Stain, OG-6

Sign In for Pricing
View Details
Mouse Ercc2 ELISA KIT
ELI-47540m 96 Tests

Mouse Ercc2 ELISA KIT

Sign In for Pricing
View Details
Claudin 14 (CLDN14) (NM_001146079) Human Over-expression Lysate
LY431799 100 µg

Claudin 14 (CLDN14) (NM_001146079) Human Over-expression Lysate

Sign In for Pricing
View Details
SYNGAP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV688077 1.0 µg DNA

SYNGAP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details