Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathepsin Z/CTSZ (C-6His)

Source: Human Cells. MW :32.51kD. Recombinant Human Cathepsin Z is produced by our Mammalian expression system and the target gene encoding Gly24-Val303 is expressed with a 6His tag at the C-terminus. Cathepsin Z is a lysosomal cysteine proteinase and belongs to the peptidase C1 family. Human Cathepsin Z contains a singnal sequence, a propeptide and a mature chain. It exhibits bothcarboxy-monopeptidase and carboxy-dipeptidase activities. In contrast to cathepsin B, it does not act as an endopeptidase. Cathepsin Z is restricted to the cells of theimmune system, predominantly monocytes, macrophages and dendritic cells. It is expressed ubiquitously in cancer cell lines and primary tumors. Like other members of this family, Cathepsin Z may be involved in tumorigenesis.

Product Specifications

Gene Name

CTSZ

Gene ID

1522

UniProt

Q9UBR2

Components

Supplied as a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIVVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Bovine Zinc finger CCCH domain-containing protein 15 (ZC3H15) ELISA Kit
MBS286601-01 48 Tests

Bovine Zinc finger CCCH domain-containing protein 15 (ZC3H15) ELISA Kit

Ask
View Details
Bovine Zinc finger CCCH domain-containing protein 15 (ZC3H15) ELISA Kit
MBS286601-02 96 Tests

Bovine Zinc finger CCCH domain-containing protein 15 (ZC3H15) ELISA Kit

Ask
View Details
Bovine Zinc finger CCCH domain-containing protein 15 (ZC3H15) ELISA Kit
MBS286601-03 5x 96 Tests

Bovine Zinc finger CCCH domain-containing protein 15 (ZC3H15) ELISA Kit

Ask
View Details
Bovine Zinc finger CCCH domain-containing protein 15 (ZC3H15) ELISA Kit
MBS286601-04 10x 96 Tests

Bovine Zinc finger CCCH domain-containing protein 15 (ZC3H15) ELISA Kit

Ask
View Details
TRAFD1, CT (TRAFD1, FLN29, TRAF-type zinc finger domain-containing protein 1, Protein FLN29) (AP) discontinued
043188-AP 200 µL

TRAFD1, CT (TRAFD1, FLN29, TRAF-type zinc finger domain-containing protein 1, Protein FLN29) (AP) discontinued

Ask
View Details
Plant Amyloid Oligomers (AO) ELISA Kit
MBS9376444 Inquire

Plant Amyloid Oligomers (AO) ELISA Kit

Ask
View Details