Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathepsin Z/CTSZ (C-6His)

Source: Human Cells. MW :32.51kD. Recombinant Human Cathepsin Z is produced by our Mammalian expression system and the target gene encoding Gly24-Val303 is expressed with a 6His tag at the C-terminus. Cathepsin Z is a lysosomal cysteine proteinase and belongs to the peptidase C1 family. Human Cathepsin Z contains a singnal sequence, a propeptide and a mature chain. It exhibits bothcarboxy-monopeptidase and carboxy-dipeptidase activities. In contrast to cathepsin B, it does not act as an endopeptidase. Cathepsin Z is restricted to the cells of theimmune system, predominantly monocytes, macrophages and dendritic cells. It is expressed ubiquitously in cancer cell lines and primary tumors. Like other members of this family, Cathepsin Z may be involved in tumorigenesis.

Product Specifications

Gene Name

CTSZ

Gene ID

1522

UniProt

Q9UBR2

Components

Supplied as a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIVVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TNPO1 knockdown cell line
ABC-KD15886 1 Vial

Human TNPO1 knockdown cell line

Sign In for Pricing
View Details
CD81 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-43118R-PE-Cy5.5 100 µL

CD81 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Prostate Specific Membrane Antigen Antibody [A11C13]
C15864-01 20 µL

Prostate Specific Membrane Antigen Antibody [A11C13]

Sign In for Pricing
View Details
Prostate Specific Membrane Antigen Antibody [A11C13]
C15864-02 100 µL

Prostate Specific Membrane Antigen Antibody [A11C13]

Sign In for Pricing
View Details
Prostate Specific Membrane Antigen Antibody [A11C13]
C15864-03 2x 100 μL

Prostate Specific Membrane Antigen Antibody [A11C13]

Sign In for Pricing
View Details
Mouse Alpha-1-B-Glycoprotein ELISA Kit
MBS076379-01 48 Well

Mouse Alpha-1-B-Glycoprotein ELISA Kit

Sign In for Pricing
View Details