Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathepsin Z/CTSZ (C-6His)

Source: Human Cells. MW :32.51kD. Recombinant Human Cathepsin Z is produced by our Mammalian expression system and the target gene encoding Gly24-Val303 is expressed with a 6His tag at the C-terminus. Cathepsin Z is a lysosomal cysteine proteinase and belongs to the peptidase C1 family. Human Cathepsin Z contains a singnal sequence, a propeptide and a mature chain. It exhibits bothcarboxy-monopeptidase and carboxy-dipeptidase activities. In contrast to cathepsin B, it does not act as an endopeptidase. Cathepsin Z is restricted to the cells of theimmune system, predominantly monocytes, macrophages and dendritic cells. It is expressed ubiquitously in cancer cell lines and primary tumors. Like other members of this family, Cathepsin Z may be involved in tumorigenesis.

Product Specifications

Gene Name

CTSZ

Gene ID

1522

UniProt

Q9UBR2

Components

Supplied as a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 4.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIVVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LILRA5 (NM_181985) Human Over-expression Lysate
LH15833V 100 µg

LILRA5 (NM_181985) Human Over-expression Lysate

Ask
View Details
CREB, phosphorylated, Ser133 (cAMP Response Element Binding Protein)
C7915-05C 100 µL

CREB, phosphorylated, Ser133 (cAMP Response Element Binding Protein)

Ask
View Details
Rottlerin 5mg
A20743-5 5 mg

Rottlerin 5mg

Ask
View Details
ADCK1 (Uncharacterized aarF Domain-Containing Protein Kinase 1, 2711-, ADCK1) (MaxLight 550)
MBS6454013-01 0.1 mL

ADCK1 (Uncharacterized aarF Domain-Containing Protein Kinase 1, 2711-, ADCK1) (MaxLight 550)

Ask
View Details
ADCK1 (Uncharacterized aarF Domain-Containing Protein Kinase 1, 2711-, ADCK1) (MaxLight 550)
MBS6454013-02 5x 0.1 mL

ADCK1 (Uncharacterized aarF Domain-Containing Protein Kinase 1, 2711-, ADCK1) (MaxLight 550)

Ask
View Details