Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C Motif Chemokine 9/CXCL9/MIG (C-6His)

Source: Human Cells. MW :12.76kD. Recombinant Human C-X-C Motif Chemokine 9 is produced by our Mammalian expression system and the target gene encoding Thr23-Thr125 is expressed with a 6His tag at the C-terminus. Chemokine (C-X-C Motif) Ligand 9 (CXCL9) belongs to the intercrine alpha (chemokine CXC) family. It is secreted by interferon stimulated monocytes, macrophages and endothelial cells, which elicits chemotactic functions by interacting with the chemokine receptor CXCR3. CXCL9 acts as a Th1 (type 1 helper T) cell chemoattractant and plays a role in the growth, activation and movement of cells associated with immune and inflammatory responses, and in tumour growth inhibition. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4.

Product Specifications

Gene Name

CXCL9

Gene ID

4283

UniProt

Q07325

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTTVDHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Evi5l (NM_001039578) Mouse Tagged ORF Clone
MR219779 10 µg

Evi5l (NM_001039578) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
N-Fmoc-8-aminooctanoic acid
459056-01 100 mg

N-Fmoc-8-aminooctanoic acid

Sign In for Pricing
View Details
N-Fmoc-8-aminooctanoic acid
459056-02 250 mg

N-Fmoc-8-aminooctanoic acid

Sign In for Pricing
View Details
IgG, Fc, X-Adsorbed (AP)
I1904-40Q 1 mg

IgG, Fc, X-Adsorbed (AP)

Sign In for Pricing
View Details
SLMAP Human shRNA Lentiviral Particle (Locus ID 7871)
TL309258V 500 µL Each

SLMAP Human shRNA Lentiviral Particle (Locus ID 7871)

Sign In for Pricing
View Details
SiR-PEG4-azide
HY-D2232 Inquire

SiR-PEG4-azide

Sign In for Pricing
View Details