Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Carnosine Dipeptidase 1/CNDP1 (C-6His)

Source: Human Cells. MW :54.9kD. Recombinant Human Carnosine Dipeptidase 1 is produced by our Mammalian expression system and the target gene encoding Pro28-His507 is expressed with a 6His tag at the C-terminus. Carnosine Dipeptidase 1 (CNDP1) belongs to the M20 metalloprotease family. CNDP1 is specifically expressed in the brain, serum and adult nervous central system. It is identified as human carnosinase. CNDP1 contains trinucleotide (CTG) repeat length polymorphism in the coding region and is inhibited by the metal chelator 1,10-o-phenantrolin. In addition, CNDP1 can hydrolyse the beta-Ala|-His dipeptide (carnosine), anserine, Xaa-|-His dipeptides and other dipeptides including homocarnosine. CNDP1 deficiency has been associated with homocarnosinosis disease.

Product Specifications

Gene Name

CNDP1

Gene ID

84735

UniProt

Q96KN2

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLHVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF394 (Zinc Finger Protein 394, Zinc Finger Protein with KRAB and SCAN Domains 14, ZKSCAN14, ZSCAN46)
MBS6012498-01 0.1 mg

ZNF394 (Zinc Finger Protein 394, Zinc Finger Protein with KRAB and SCAN Domains 14, ZKSCAN14, ZSCAN46)

Ask
View Details
ZNF394 (Zinc Finger Protein 394, Zinc Finger Protein with KRAB and SCAN Domains 14, ZKSCAN14, ZSCAN46)
MBS6012498-02 5x 0.1 mg

ZNF394 (Zinc Finger Protein 394, Zinc Finger Protein with KRAB and SCAN Domains 14, ZKSCAN14, ZSCAN46)

Ask
View Details
Porcine Actinin Alpha 3 ACTN3 ELISA Kit
BG-POR10068 1 Each

Porcine Actinin Alpha 3 ACTN3 ELISA Kit

Ask
View Details
Mouse cluster of differentiation (CD44) ELISA Kit
YP-W21749-01 48 Tests

Mouse cluster of differentiation (CD44) ELISA Kit

Ask
View Details
Mouse cluster of differentiation (CD44) ELISA Kit
YP-W21749-02 96 Tests

Mouse cluster of differentiation (CD44) ELISA Kit

Ask
View Details
Mouse Monoclonal GFR alpha-4/GDNF R alpha-4/Persephin receptor Antibody (MM0311-3P34) [Alexa Fluor 700]
NBP2-12414AF700 0.1 mL

Mouse Monoclonal GFR alpha-4/GDNF R alpha-4/Persephin receptor Antibody (MM0311-3P34) [Alexa Fluor 700]

Ask
View Details